[HN Gopher] I've stopped using box plots (2021)
       ___________________________________________________________________
        
       I've stopped using box plots (2021)
        
       Author : colinprince
       Score  : 359 points
       Date   : 2024-06-23 06:26 UTC (1 days ago)
        
 (HTM) web link (nightingaledvs.com)
 (TXT) w3m dump (nightingaledvs.com)
        
       | jcims wrote:
       | What about violin plots.
       | 
       | https://en.m.wikipedia.org/wiki/Violin_plot
        
         | 317070 wrote:
         | I was thinking the same thing while reading, but the author
         | does mention them at the end (together with the bee swarm plot
         | or sina plot, which I think is the better version of a violin
         | plot)
         | 
         | https://www.rhoworld.com/i-swarm-you-swarm-we-all-swarm-for-...
        
         | Scea91 wrote:
         | I use violin plots but a complication is that the shape depends
         | upon the bandwidth hyperparameter of the kernel density
         | estimator that is used inside. The plot can differ a lot for
         | different bandwidth values.
         | 
         | Selection of the 'proper' bandwidth is a classic bias-variance
         | tradeoff problem.
        
           | IshKebab wrote:
           | While true, that's not an additional problem compared to box
           | plots which effectively just set the bandwidth to maximum. So
           | IMO they are strictly better.
        
             | IanCal wrote:
             | I find violin plots suggest far smoother results than
             | actually exist so you need to be careful with the amount of
             | data.
        
               | IshKebab wrote:
               | I agree but so do box plots. I think probably the best
               | thing is violin plots when there's lots of data and bee
               | swarm plots when there isn't. But either are better than
               | box plots.
        
               | karmakaze wrote:
               | What about using rotated, symmetric histograms--like a
               | quantized violin plot?
        
         | mjfisher wrote:
         | The author mentions those at the bottom of the article, but two
         | problems highlighted still remain:
         | 
         | * There's another intermediary concept (kernel density
         | estimation) between the audience and the data
         | 
         | * They're still likely to misrepresent tight groupings and
         | discontinuities, which will be smoothed out
        
           | adammarples wrote:
           | Histograms and box plots are just clunky kernels density
           | estimates too
        
       | bdjsiqoocwk wrote:
       | The author just has a bad intuition. On the first picture he says
       | "this looks like a small quantity". No, you can't say that. All
       | you can say is that half the data points are in the shades part.
       | You don't know where the rest are.
        
         | Jaxan wrote:
         | I don't think intuition is the right word. If you have never
         | seen a box plot before, your intuition will not help parse it.
         | (Unlike violin plots.)
        
           | wyldfire wrote:
           | In my experience of sharing violin plots with people who are
           | unfamiliar with them, it's not intuitive that the curve
           | represents the distribution. Even with the scatter plot
           | over/underlaid.
           | 
           | But that's okay, I don't mind explaining it and then the
           | graph is easier to interpret imo.
        
         | wesleywt wrote:
         | You need to develop the intuition in the first place to read
         | box-plots. The author argues that there are other plots where
         | you don't require intuition.
        
         | ncruces wrote:
         | > You don't know where the rest are.
         | 
         | Of course you do: they're in the whiskers; half in each
         | whisker.
         | 
         | That's the entire point of the picture, BTW.
        
           | lkdfjlkdfjlg wrote:
           | You're right. I guess that's not the author's mistake then.
           | His mistake is assuming "the whisker is small, therefore it
           | has a small number of datapoints".
        
             | ncruces wrote:
             | That's not his mistake. He knows this, but repeatedly
             | failed to convey this to others.
             | 
             | That's like the entire point of the post: they're hard to
             | teach to others (they're unintuitive) and there are better
             | (more intuitive) alternatives.
             | 
             | I dunno if I agree, but it's ironic that this thread
             | started with a poster complaining about the author's bad
             | intuition, while apparently managing to not have a good
             | grasp of box plots themselves.
        
               | lkdfjlkdfjlg wrote:
               | What are you talking about? I have a perfect grasp of
               | these things. As I said, half is in the shape area. You
               | must've missed that.
               | 
               | Also, that IS his mistake, it's literally the first thing
               | in the post. And this stuff isn't hard or hard to teach
               | _at all_ has long as you're at least 5.
        
               | ncruces wrote:
               | This thread started with _bdjsiqoocwk_ , who wrote:
               | 
               | > You don't know where the rest are.
               | 
               | This is wrong, period. And the fact it's wrong is pretty
               | much the entire point of the article.
               | 
               | Are _bdjsiqoocwk_ and _lkdfjlkdfjlg_ the same poster?
               | 
               | Please don't pick a needless fight.
        
         | kzrdude wrote:
         | The "this looks like a small quantity" comparison is wrong,
         | because it's pointing to the lowest quartile, which has a
         | cutoff which looks like 0 to <8 or so. While the histogram
         | count compared to is using a bit of 0 to <10 - so it's not
         | comparing the same counts, unfortunately. Having the historgram
         | also count quartiles (or bins that add up evenly to quartiles)
         | would drive that point home a lot better.
         | 
         | Apart from that quibble, it's a point very well taken.
        
       | rhdunn wrote:
       | When profiling slow queries/code I often collect the elapsed time
       | of a test where I take 5-10 runs and calculate the mean/average,
       | standard deiviation, min, and max.
       | 
       | As well as using line charts on the average, I've used a box plot
       | (with the edges of the box being the mean +/- 1 standard
       | deviation) to get an idea of whether a given change is
       | significant or not. I.e. if the boxes are close together I will
       | ignore a change I've made, only committing changes that provide a
       | significant jump in performance. The box plot is a useful way of
       | visualizing that.
       | 
       | They can help with seeing highly variable performance (long box)
       | from consistent performance (narrow box).
       | 
       | I can see this in the data (mean, standard deviation) but having
       | it represented visually can help -- especially looking at the
       | data over several iterations, or when looking for patterns from
       | changing a variable (like the number of items in the data being
       | processed).
       | 
       | I've also used linear regression calculations when data has
       | looked linear or quadratic to check/confirm that assumption. --
       | You can overlay that on top of the data by computing the values
       | for each value of n along side the actual data average and then
       | including the average and calculated values in a line chart.
        
       | SillyUsername wrote:
       | So the diagram should not be used because of an education problem
       | with some audiences?
       | 
       | Isn't that a bit like banning cars because some people can't
       | drive?
       | 
       | Some diagrams are simply not for mass consumption and this is
       | one, particularly because it is designed to illustrate an
       | interpretation of ranges instead of the direct/linear
       | representation of the raw data.
       | 
       | Of course I'd illustrate this fact as a Venn diagram comparing
       | "box diagram" Vs "people" (intersection those who understand it)
       | but I'm afraid the universal set may be mistaken as "those people
       | who don't have eyes" rather than literally everything else.
       | 
       | Perhaps we should stop using that too, since it's non obvious
       | what the universal set is.
       | 
       | All diagrams have some ambiguity and can be misinterpreted,
       | sometimes it's deliberate (e.g. bar chart vertical axis not
       | starting at 0 or scale not being linear) and that's why there's
       | the saying "There's lies damn, lies, and statistics." That
       | doesn't mean some diagrams are not useful, just that it's not
       | suitable for some audiences who may misinterpret the data.
        
         | 317070 wrote:
         | It's not like banning cars, it is like banning horse carriages
         | on high ways.
         | 
         | We have better technology nowadays, including for plotting, so
         | why not ditch the old?
         | 
         | The author of the blog post has some good arguments. From your
         | post, I cannot distill an argument as to why you would prefer
         | specifically a box plot over a strip plot.
        
           | SillyUsername wrote:
           | Yes the other diagrams are better for mass consumption, and
           | illustrating direct representation of the data distribution.
           | 
           | But that's not the purpose of a box diagram and the article
           | even did a side by side comparison showing an apples and
           | oranges comparison of 2 total different representations of
           | the data.
           | 
           | Those diagrams were never meant to represent the data in the
           | same way.
           | 
           | The article simply could have shown a better way of
           | illustrating the data, rather than implying box diagrams are
           | incorrect, which they aren't, any more than choosing a bad
           | graph or axis is (CF. parent comment)
        
             | cqqxo4zV46cp wrote:
             | IIn all of your replies you make snide reference to
             | "general audiences", "mass consumption", etc. You very
             | obviously place yourself in a higher class because of your
             | ability to correctly interpret box plots. Can we please
             | just move past that though? The vast vast vast majority of
             | box plots are for "general consumption". The vast vast
             | majority of box plots are used in place of a more suitable
             | chart type. You seem to be arguing that, because a box plot
             | is hypothetically suitable for some (in the grand scheme of
             | things) corner case, that the author's point is faulty. I
             | think that you are completely overstating the importance of
             | the hypothetical 'correct case'. You're getting stuck on a
             | point that nobody, least of all the author, is making.
        
         | mkl wrote:
         | When there are alternatives that are clearer and also don't
         | have this education problem, why use box plots? You seem quite
         | keen on them, but why?
        
           | SillyUsername wrote:
           | There are a few advantages (see visualization section here
           | pls http://en.m.wikipedia.org/wiki/Box_plot ) but my main
           | concern is that the problem is not with the diagram, it's
           | with idea that it's somehow faulty.
           | 
           | Sometimes you may want to highlight some core representation
           | of data without the distraction of outliers (yes that does
           | mean some people will use it for deliberate
           | misrepresentation). But in this regard it's useful, as is on
           | bar graphs not starting the vertical at 0 (because you want
           | to illustrate relate difference not absolute amounts).
        
             | Angostura wrote:
             | The article doesn't really argue that they are "faulty"
             | just that there are better alternatives in the large
             | majority of cases. I think he makes a compelling argument
        
               | SillyUsername wrote:
               | Fair enough, it was the comment that "better-designed
               | chart types" that caught my eye. "better designed for
               | general use" should have been the context I read it in.
        
         | quenix wrote:
         | Driving isn't a medium of communication, so this is an apples
         | to oranges comparison.
         | 
         | If a medium of communication is misunderstood and found to be
         | misleading to your audience, it doesn't really matter whether
         | it's an education problem or not. It ceases to be a good
         | communication medium.
         | 
         | The entire purpose of data viz as the author discussed is to
         | convey ideas to other people. The author argues that people
         | tend to misunderstand this specific chart type. It is valid,
         | then, to dismiss the visualisation as bad for public
         | communication.
         | 
         | Unfortunately, the technical merits of these things don't
         | matter if most people don't understand them.
        
           | SillyUsername wrote:
           | As I've mentioned in other comments less succinctly, data
           | hiding is sometimes useful of for drawing attention to other
           | areas.
           | 
           | There are the better graphs the author mentioned for general
           | purpose use, but the graph itself isn't at fault any more
           | than using a bar chart with a poor scale (e.g omit 0-20) to
           | do the same hiding.
        
             | cqqxo4zV46cp wrote:
             | What specific issue do you have with this article? "The
             | graph itself isn't at fault" is very "guns don't kill
             | people, people kill people". Who cares? This distinction is
             | utterly meaningless semantics. Why do you feel a need to
             | 'stand up' for box plots? Why is this a tribalistic
             | religious war?
        
           | JumpCrisscross wrote:
           | > _Driving isn 't a medium of communication_
           | 
           | There is a lot of implicit ( _e.g._ traffic signals) and
           | explicit ( _e.g._ indicators and horns) inter-driver
           | communication that is at the heart of most crashes.
        
         | cqqxo4zV46cp wrote:
         | If this is your approach, the only way you ever could've made
         | anything actually useful is by sheer coincidence. Box plots,
         | and their alternatives, are communication tools. Do you not
         | care to find a more clear way to communicate? In drawing an
         | immediate comparison with banning cars, you're being completely
         | unjustifiably standoffish.
        
         | sloowm wrote:
         | Why would you even use plots at all. You could just show the
         | numbers for the 4 points represented in the box plot and people
         | with proper education would understand. If people need diagrams
         | it's just an education problem with some audiences.
         | 
         | But the real education deficit shown here is psychology
         | education. Humans are bad at doing some calculations
         | inherently. They are not able to properly asses pie charts and
         | easily confused by numbers with a lot of digits. Even before
         | these studies were done people were able to come up with
         | visualizations that were better suited for human understanding.
         | 
         | People chose to use box plots because the visualization was
         | better to understand by people than the numerical
         | representation of the same information. Luckily there are now
         | even better tools to represent the same numerical data in a way
         | that is even better to understand.
         | 
         | So, if you are truly educated properly you don't use
         | visualization.
        
         | munch117 wrote:
         | > So the diagram should not be used because of an education
         | problem with some audiences?
         | 
         | A problem like this one that he mentions, "People associate
         | longer shapes with greater quantity", is not something you can
         | fix by teaching. Even if you know intellectually that the
         | association is, in this case, wrong, you can't free yourself
         | from the association. It's hardwired into the brain.
         | 
         | People who work with this sort of diagram a lot will eventually
         | build up context-specific associations that work better,
         | overriding that instinct, to the point where it feels seamless.
         | But even if it feels seamless and easy, the dissonance is still
         | there, and may lower your comprehension speed and slightly
         | impair your judgment.
         | 
         | As a statistics expert, you are never going to notice that,
         | because your baseline comprehension speed and judgment on the
         | subject is so good, that this very minor impairment is lost in
         | the noise. So you may not be a good judge of the usability
         | qualities of the diagram type.
        
       | ekianjo wrote:
       | just use boxplots with an overlay of the actual data and any
       | confusion goes away
        
         | flumpcakes wrote:
         | This is the way to go in my opinion. I think it's the easiest,
         | most straight forward, and not confusing to the reviewer. You
         | shouldn't be using box plots to describe the shape of data to
         | begin with, but having a ghost/after image/super imposition can
         | probably only help in cases where you need to communicate that
         | the shape is different, even if the statistical nature is the
         | same.
        
       | cjk2 wrote:
       | No you shouldn't stop using box plots. You should use them for
       | when they are appropriate - showing location and spread. And not
       | shape! There's absolutely no information on modality or
       | distribution presented past quartiles and limits.
       | 
       | They are mostly useful for comparing batches not analysing an
       | individual batch.
       | 
       | The author doesn't know what they are talking about and is
       | telling people as if they do. If he read any of Tukey's material
       | he might know. But no name dropping is enough clearly...
        
         | ohmyiv wrote:
         | > No you shouldn't stop using box plots. You should use them
         | for when they are appropriate
         | 
         | Yes, the author is aware of that. They even stated so:
         | 
         | > Despite making more visual sense than box plots, I still
         | wouldn't recommend these design concepts or box plots in most
         | situations because...
         | 
         | Seems a few people missed the "in most situations" part. He's
         | saying he stopped using them for whatever reasons because it
         | isn't working for his audience. So as the title suggests, maybe
         | we should all take a look at our use of box plots and see if
         | there are better alternatives.
         | 
         | Also remember who he's talking about when it comes to reading
         | box plots. He's not talking about people who understand box
         | plots. He's talking about others that don't know or understand
         | box plots, which seems to be thousands of people he's had to
         | explain it to, according to him.
        
           | cjk2 wrote:
           | The author doesn't use the correct terminology and does not
           | understand box plots themselves so they are in no position to
           | explain them to anyone. They explain in terms of absolutes
           | with no rational or scientific explanation and entirely miss
           | the point of the methodology and tools. That is a not a good
           | position to start or a good person to take advice from.
           | 
           | Not only that, the cases presented are likely better dealt
           | with via inference tests. But the author's knowledge doesn't
           | extend that far. And even going as far left, the posed
           | question isn't even defined in the article. So how was a
           | suitable methodology chosen? Well it wasn't - lets just throw
           | this pretty picture up and whine about it.
           | 
           | The author is way out of their depth and should retract the
           | article and take a formal, accredited statistics course.
        
             | scrollaway wrote:
             | Is this sarcasm?
             | 
             | I'm not one to appeal to authority but "author should take
             | a course" is akin to ad hominem when a quick look at their
             | profile (https://www.practicalreporting.com/about-nick-
             | desbarats - https://www.linkedin.com/in/nickdesbarats/)
             | tells you that he's been doing dataviz and statistics for a
             | long time.
        
               | cjk2 wrote:
               | Nope.
               | 
               | I'm not one to appeal to authority either which is why I
               | am making objective arguments about what is presented.
               | 
               | And yes he should go on a stats course. I dread to think
               | the chaos he's spread to people who don't know better.
        
             | ohmyiv wrote:
             | > The author is way out of their depth and should retract
             | the article and take a formal, accredited statistics
             | course.
             | 
             | Maybe you should learn about the author before you make
             | such assumptions. I find it hilarious you think he should
             | take statistics courses when he teaches data visualization
             | workshops to places like NASA, IRS, and the UN.
             | 
             | I'm done with this thread. Such a joke.
        
               | cjk2 wrote:
               | Oh I know the author.
               | 
               | Just because you're high profile in the data viz industry
               | doesn't mean you should be commenting on statistics
               | especially with such a clear misunderstanding going on.
               | 
               | Some of us are definitely more qualified to speak on
               | these matters and we still don't think we're qualified to
               | teach it.
        
               | ubercow13 wrote:
               | If box plots require an formal and accredited statistics
               | course to understand, but as you mention they are taught
               | to 15 year olds (presumably incorrectly) in school and
               | used by people with power making decisions that affect
               | everyone in organisations such as the UN and NASA, then
               | even if the author is unqualified it seems their point is
               | 'accidentally' correct. No one should be using these
               | plots except extremely smart and trained people who do
               | know how to read them, as it could have serious negative
               | consequences.
        
             | pocketsand wrote:
             | I do stats and data viz for a living and the article seemed
             | perfectly reasonable to me.
             | 
             | He isn't dogmatic.
             | 
             | He makes reasonable arguments.
             | 
             | I'm confused by these hopelessly uncharitable readings of
             | the article.
        
         | sloowm wrote:
         | You absolutely should stop using box plots. The only reason to
         | use them is because you have to draw a representation by hand
         | and do not have access to a computer.
         | 
         | A box plot is a data compression technique for compression by
         | hand. There are now better automated techniques that both
         | preserve data quality and visual quality better.
        
         | magnio wrote:
         | You are looking at this as a technical problem, where box plot
         | is a compact visual representation of variance and outliers
         | that is perfectly perfunctory as it is cromulent.
         | 
         | The author is approaching this as a _human_ problem. Plots are
         | not made for machines, they are for people to read, and the
         | author specifically wants as many people can read and parse
         | plots easily as possible. As lamentable as math education might
         | be, we have to work with what we have, and I do think it is a
         | reasonable goal. I agree with the author that it should not be
         | necessary to know what quartiles are in order to see how spread
         | out a distribution is.
        
           | cjk2 wrote:
           | So your approach and the author's is to dumb a technical
           | measure down to a level where the observer doesn't need to
           | understand what they are looking at.
           | 
           | Well that explains the entire data visualisation and
           | dashboard consultancy nicely.
           | 
           | How does anyone rationalise the information they have if they
           | don't make an effort to understand it. Or how can they even
           | select a visualisation method or comparison method. We are
           | truly fucked!
        
             | kibwen wrote:
             | _> So your approach and the author's is to dumb a technical
             | measure down to a level where the observer doesn't need to
             | understand what they are looking at._
             | 
             | this is precisely why i don't bother with capitalization in
             | my sentences.
             | 
             | in fact even punctuation isnt necessary i dont see why i
             | should dumb down my explanations for people who arent going
             | to make an effort to understand them
             | 
             | actuallyevenspacesaresimplyredundantandasufficientlysmartre
             | adershouldjustunderstandmymeaningwithoutmeneedingtodelineat
             | emywordswhataretheyachildifthiswasgoodenoughfortheancientro
             | mansthenitsgoodenoughforme
             | 
             | hckvnvwlsrrdndntndfnynsysthrwsthnmycnclsnsthtthrbrnsrnsffcn
             | tlylrgtcmprhndmygns
        
             | nkrisc wrote:
             | Do you want to be right, or do you want to be understood?
             | 
             | You can't control what other people do. You can try to meet
             | them where they are, or hope they'll catch up with you.
             | Hopefully it's not your problem if they fail to.
        
       | psyklic wrote:
       | Box plots make distributions easier to reason about by
       | oversimplifying them. In a similar way, the mean can be very
       | misleading (but we likely won't forbid its use!).
       | 
       | IMO a good takeaway might be to always use a plot that fairly
       | represents the underlying distribution.
        
       | sigmoid10 wrote:
       | >box plots always make distributions look bell shaped
       | 
       | I feel like this is where the confusion stems from for the author
       | and everyone else here. Box plots don't make anything bell shaped
       | (they don't change the distribution), they _assume_ that your
       | data follows a bell /gaussian shape. This is correct in cases
       | where the central limit theorem can be applied (which is almost
       | everywhere) - but when that is not the case, the assumption is
       | wrong and you shouldn't use a box plot anyways, because the
       | values it shows have no real use. There are very real use cases
       | for box plots, but people need to understand the basics of
       | statistics before they can use them.
        
         | blueflow wrote:
         | This should be the topmost comment. Box plots are made for
         | visualizing generalized normal distributions and nothing else.
         | 
         | Edited to preempt nitpick.
        
           | cjk2 wrote:
           | This is also wrong. Gaussian curves are symmetric. Box plots
           | do not have to be. In fact representing skew in a batch is
           | one of the fundamental purposes of them.
        
             | crazygringo wrote:
             | But representing skew is precisely to show how "off" from a
             | Guassian it is.
             | 
             | Because real data is never perfectly Guassian, or perfectly
             | anything.
             | 
             | But the idea of a box plot is that it's for data which is
             | _in theory_ Gaussian or a similar unimodal kind of bell-
             | shaped curve.
             | 
             | Then you can look at the box plot and see if it actually
             | _is_ -- are the two boxes roughly equal-sized? Are the
             | lines a bit longer than the boxes but not insanely so?
        
               | blueflow wrote:
               | You model skew in Gaussian distributions by adding an
               | exponential parameter.
        
           | pocketsand wrote:
           | Why? They're non-parametric and make zero assumptions of
           | normality.
        
             | blueflow wrote:
             | How else would you calculate the quartiles to render the
             | boxes?
        
               | munch117 wrote:
               | Count data points in each quartile. You can do that for
               | any sortable data, independent of distribution.
        
               | blueflow wrote:
               | If you do that in your paper, you better write next to
               | the graph that you did that.
        
               | thaumasiotes wrote:
               | Arguing that nobody who might be professionally expected
               | to look at a box plot can be reasonably expected to
               | understand how box plots are defined doesn't make a
               | compelling case that using them is a good idea.
        
               | blueflow wrote:
               | If the method how the plot boxes are calculated is not
               | clear (this thread references at least two different
               | methods), you'll need to explicitly write it down which
               | methods you did use.
        
               | thaumasiotes wrote:
               | > this thread references at least two different methods
               | 
               | No, as the sidethread comment notes, there is only one
               | way you _can_ compute quartiles. You seem to be arguing
               | that the correct thing to do is to impute them, and that
               | _calculating_ them is such a deviant practice that it
               | would need to be specially remarked on.
        
               | blueflow wrote:
               | Isn't this what i was saying from the beginning?
               | Box plots are made for visualizing generalized normal
               | distributions and nothing else.
               | 
               | And now people in this thread argue you can calculate
               | them from something else. Not sure if you are replying to
               | the right post.
        
               | thaumasiotes wrote:
               | That might be what you were saying from the beginning,
               | but the only thing that that would establish is that
               | you're completely out of touch with reality. Box plots
               | are made for visualizing quartiles.
               | 
               | Your theory would imply, among other things, that the
               | median line going through the box part of a box plot
               | always divides it in half, which obviously is not the
               | case.
        
               | blueflow wrote:
               | No? Exponential Gaussian?
               | 
               | Whatever you do, you should explain first what you do
               | that your whiskers stay meaningful and are not just
               | whatever randomness your outliers produced.
        
               | A4ET8a8uTh0 wrote:
               | It is actually a fascinating argument that shows how
               | little of what is being decided is based on actual data (
               | or at least our understanding of it ), but rather that
               | data visualization is being used to push already pre-
               | approved decisions with data being used merely as a 'for'
               | argument.
               | 
               | I agree that if there is an indication that if most
               | professionals don't really know what boxplot is supposed
               | communicate, maybe it should not be used.
        
               | munch117 wrote:
               | Perhaps I expressed myself poorly, and left room for
               | misunderstanding, because I cannot possible imagine that
               | we have any real disagreement on how to compute
               | quartiles.
               | 
               | Any set of numbers I give you, you can compute quartiles
               | for it. There is no algorithm for doing that that breaks
               | down if the numbers don't follow a normal distribution.
        
               | blueflow wrote:
               | Look at this SVG from wikipedia: https://upload.wikimedia
               | .org/wikipedia/commons/1/1a/Boxplot_...
               | 
               | When you calculate the box plot using normal distribution
               | parameters, the outliers are outside the outer bracket.
               | 
               | If you split the dataset into 4 equal parts, the bracket
               | will be larger because the outliers are still inside it.
               | 
               | The methodologies are not equal.
               | 
               | This thread is the first time i heard people do the
               | "split dataset into 4 quarters" and using that for box
               | plots.
        
               | pocketsand wrote:
               | As I'm sure you know, there are a lot of variations on
               | how quantiles are calculated in various software. The
               | 25th percentile, e.g., doesn't always line up with a
               | value in the dataset, so sometimes nearest rank methods
               | are used, otherwise a linearly interpolated data point,
               | where interpolation is done in various ways.
               | 
               | In any event, none of these methods assume normality, or
               | rely on CDFs of a normal curve.
               | 
               | If they did, every box plot would be symmetric.
               | 
               | The fact some people think that boxplots are constructed
               | in such a way is a pretty good reason to take the
               | author's article seriously as for how boxplots are
               | confusing.
        
               | ColFrancis wrote:
               | For what it's worth, you've convinced me that my beloved
               | box plots need to be explained if I want to use them
               | again.
               | 
               | The SVG you've provided clearly shows that the box plot
               | splits the data in 4. The interquartile range (IQR) is
               | clearly marked and it even has a comparison for what the
               | standard deviation (variance) measure would be.
               | 
               | Secondly, if the data truly came from a normal
               | distribution, there are no outliers. Outliers are data
               | points which cannot be explained by the model and need to
               | be removed. Unless you have a good reason to exclude the
               | data points they should be included. This is why I like
               | the IQR and the median, they are not swayed by a few wide
               | valued data points. The 1.5*IQR rejection filter I think
               | is lazy and unjustified. Happy to discuss this point
               | further as it is a bug bear of mine.
        
               | blueflow wrote:
               | When i said "splitting", i meant it like my parent
               | explained: Basically sorting your datasets and then
               | splitting into quarters.
               | 
               | What you want to explain to me (IMHO to the wrong person)
               | is the correct approach of calculating a mean and
               | standard deviation and drawing the box from that. Lets
               | stay with that (and thats what i said earlier in the
               | thread)
               | 
               | After i wrote the post you replied to, i realized that
               | the pure "splitting" method for box plots is nonsensical
               | since the outer brackets interval is determined by the
               | two most extreme values. They are too random to be
               | meaningful. It does not make sense to draw a box plot
               | from that.
        
               | blueflow wrote:
               | On second thought, this method makes the outer brackets /
               | whiskers pretty much useless since their position is
               | determined by the largest outliers, which is quite much
               | random.
        
               | Falkon1313 wrote:
               | That's not how they're drawn. Outliers (More than 1.5
               | times the interquartile range outside the 1st/3rd
               | quartile) are plotted as dots beyond the whiskers. The
               | whiskers go at Q1-1.5xIQR and Q3+1.5xIQR.
        
               | blueflow wrote:
               | Better is! Look what i was replying to.
        
           | munch117 wrote:
           | But is that what they're actually used for?
           | 
           | The data has been reduced to three numbers, throwing away
           | most of the information that you would need to assess whether
           | the distribution is gaussian or not. If it's not, how will
           | you ever know?
        
         | cjk2 wrote:
         | Exactly this on the last point. Although rereading this the
         | distribution point is explained poorly.
         | 
         | People waltz in with assumptions and then complain when they
         | don't work because they don't really understand the tools they
         | are using. The author is one of them. It's a bad article and
         | the author should not be using or demonstrating things they
         | clearly don't understand.
        
           | munch117 wrote:
           | Isn't that the whole point? That the graph type is very easy
           | to misunderstand. If you are right, and not even a
           | professional data visualization consultant properly
           | understands the graph, then who will?
        
             | cjk2 wrote:
             | Some of us are perfectly qualified to understand them and
             | the nuances.
        
               | munch117 wrote:
               | A plot that requires the reader to be perfectly qualified
               | is a bad plot.
        
               | cjk2 wrote:
               | They teach this to 15 year olds in the UK.
               | 
               | If it's a bad plot, perhaps some introspection is
               | required...
        
               | magicalist wrote:
               | They also teach pie charts and use color scales with non-
               | uniform brightness. Just because it's possible to read a
               | plot doesn't make it a good plot.
        
         | Beldin wrote:
         | > Box plots [...] assume that your data follows a bell/gaussian
         | shape.
         | 
         | Not sure how to square that with this statement on Wikipedia's
         | page on box plots:
         | 
         |  _Box plots are non-parametric: they display variation in
         | samples of a statistical population_ without making any
         | assumptions _of the underlying statistical distribution[3]_
        
           | sigmoid10 wrote:
           | If you want to see why that is not fully correct you should
           | read the article. For a box plot you need to calculate mean,
           | variance and certain percentiles. These values don't make
           | sense if your distribution does not follow a certain shape
           | (because these values unambiguously define such a shape). See
           | the examples in the article for what happens if you still try
           | to use them in those cases. You can still extract the values
           | of course (hence probably why wiki says they don't assume
           | anything), but you lose significant information about the
           | distribution. So you can no longer reverse the process.
        
             | rcxdude wrote:
             | The mean and variance are not features of a box plot. Box
             | plots show the quartiles, which are about the cumulative
             | distribution.
        
               | lolc wrote:
               | Which is why I find the article so compelling because I'd
               | always read box plots as being about variance. To me the
               | plot implied a quite normal distribution.
        
               | fjkdlsjflkds wrote:
               | Note that "not knowing how to correctly interpret a
               | boxplot" is not equivalent to "boxplots are useless".
        
               | lolc wrote:
               | If people like me are in the audience, they might be
               | worse than useless.
        
               | fjkdlsjflkds wrote:
               | Sure. But if someone is using, for example, a notched
               | boxplot to quickly evaluate differences in medians (i.e.,
               | they know how to correctly interpret a boxplot), it can
               | still be a useful plot that conveys specific information
               | that you would otherwise not get when looking at a violin
               | plot, histogram, kernel density estimate or a strip plot.
               | 
               | My point, again, was: just because a boxplot is not
               | useful to _some_ people, doesn 't mean that it is not a
               | useful plot (particularly when augmented with a rugplot
               | or a strip plot). Plots are not just used to convey
               | information to _others_ : they are also a useful tool in
               | exploratory data analysis.
               | 
               | Notice that you can also apply the same critique to
               | almost any plot: _some_ people don 't know how to
               | interpret a violin plot (or kernel density estimate plot)
               | correctly... does that make them useless?
               | 
               | The main advantage of a boxplot is that it is parameter-
               | free (unlike histograms, violin plots and kernel density
               | plots) and quickly conveys very specific information
               | (median, range, quantiles, confidence interval for the
               | median) that other types of plot usually don't.
        
             | These335 wrote:
             | Mean and variance have nothing to do with boxplots, you are
             | mistaken.
        
             | JumpCrisscross wrote:
             | > _For a box plot you need to calculate mean, variance_
             | 
             | Quantiles and medians. (Plus min and max.) Non-parametric.
        
             | Evidlo wrote:
             | > So you can no longer reverse the process
             | 
             | I've never understood this to be the purpose of a boxplot,
             | only a means of visualizing a distribution's quartiles.
             | 
             | You've gotten a flood of comments from upset people, so
             | I'll keep it short by saying that a boxplot doesn't
             | actually do what you claim for Gaussians, as the 0 and 100
             | percentile "whiskers" would be at plus/minus infinity. As
             | for a bounded bell-shaped distribution, there are several
             | non-unique ways to define such a distribution.
        
               | crazygringo wrote:
               | > _as the 0 and 100 percentile "whiskers" would be at
               | plus/minus infinity_
               | 
               | The point is not to plot an ideal Gaussian, the point is
               | to plot the data.
               | 
               | In real life the whiskers are the actual minimum and
               | maximum values observed.
        
               | blueflow wrote:
               | > In real life the whiskers are the actual minimum and
               | maximum values observed.
               | 
               | Look at this: https://upload.wikimedia.org/wikipedia/comm
               | ons/1/1a/Boxplot_...
               | 
               | 0.7% of all values are outside the whiskers.
        
               | crazygringo wrote:
               | There are two standard ways of doing box plots. One is
               | miniums and maximums, the other is the 1.5 IQR method.
               | 
               | The very Wikipedia article your image comes from explains
               | this:
               | 
               | https://en.wikipedia.org/wiki/Box_plot#Whiskers
        
             | gradstudent wrote:
             | > because these values unambiguously define such a shape
             | 
             | I think this is a misunderstanding, and I think it is
             | shared by the author of the article. Boxpolots show ranges.
             | That's it.
        
         | treflop wrote:
         | I agree. The author simply used the wrong chart.
         | 
         | The author's example has a bimodal distribution (TWO peaks) and
         | chooses a type of chart that has ONE peak (a box plot).
         | 
         | A little baffling tbh.
        
           | rcxdude wrote:
           | Well, to start with, how would you determine that about your
           | distribution in the first place? And if that works well
           | enough, why use a box plot afterwards?
        
             | cjk2 wrote:
             | Because it's very hard to rationally compare multimodal
             | batches without single test statistics. And they present
             | five summary figures for each batch, each of which are
             | reasonable metrics to compare batches with.
        
             | treflop wrote:
             | Well usually when you are analyzing some data, you toss it
             | into the most basic chart like a histogram.
             | 
             | And a histogram for the author's example is perfectly
             | acceptable to show that _single_ data series.
             | 
             | But imagine if you have 10 different normal data series and
             | you want to compare their medians and distributions between
             | each other... well are you going to put 10 histograms side
             | by side and expect the reader to compare them? No -- that's
             | where the box and whisker plot shines.
        
             | smcin wrote:
             | Simple, use a histogram.
             | 
             | The author's first histogram clearly shows most of the
             | distribution lies in [20,100), then the [10,20) bin is
             | empty but the [0,10) bin is quite full. Hence, that's not a
             | single-mode distribution. It has two modes, one around
             | [50,60) and the other in [0,10).
        
             | WWWWH wrote:
             | Yes, exactly! Just plot all the bloody data and be done
             | with it. No one is doing this by hand anymore so it is no
             | extra work.
             | 
             | To my mind, if you have a genuine EDA attitude you plot it
             | all.
        
               | crazygringo wrote:
               | > _Just plot all the bloody data and be done with it_
               | 
               | Well no, because you can compare the datasets by eye and
               | say questionable _qualitative_ things about them, but you
               | can 't make definitively true _quantitative_ statements
               | about them.
               | 
               | Show me two plots of data points and I can show you two
               | people who will in good faith argue over which one has
               | the higher mean or higher median or higher variance.
               | Because you often can't tell.
               | 
               | The entire point of something like a box plot is that it
               | does part of the quantitative analysis for you. You can
               | see where the median is. You can see the width of the
               | quartiles.
        
               | theamk wrote:
               | But there are much better ways to do this than box plots!
               | Lots of CS papers use CDF and it's great and very
               | informative once you get used to it (although you do need
               | to get used to them). You can have violin plots with all
               | the box plots elements and more. Even if you want to
               | restrict yourself to quartiles, author's design concepts
               | with narrow/wide bars makes much more visual sense, and
               | still convey exactly the same information as box plots.
        
               | crazygringo wrote:
               | It depends on the purpose.
               | 
               | CDF plots are great for plotting a single distributions,
               | but contain way too much information if you want to plot
               | 6 distributions next to each other for easy comparison.
               | 
               | Violin plots are interesting but also quite complicated,
               | since you have to arbitrarily choose a kernel shape and
               | this artificial smoothing can make it look like you have
               | much more data than you really do.
               | 
               | I really don't like the author's "alternative designs"
               | because I think they're even more open to
               | misinterpretation than box plots. It's hard to judge
               | though, because the central problem is that the author is
               | trying to represent a bimodal distribution, and shouldn't
               | be using box plots _or_ the 2  "alternative designs" for
               | that.
        
           | thaumasiotes wrote:
           | > and chooses a type of chart that has ONE peak (a box plot)
           | 
           | Huh? A box plot doesn't have any peaks. A box plot is a
           | histogram subject to the constraint that every bar in the
           | histogram is equally tall. There can never be more than zero
           | peaks.
        
         | ozyschmozy wrote:
         | > There are very real use cases for box plots,
         | 
         | The author argues otherwise, can you give an example of a use
         | case where box plots would be preferable to the alternatives
         | the author suggests?
        
           | ohmyiv wrote:
           | > There are very real use cases for box plots,
           | 
           | > The author argues otherwise
           | 
           | No, in the article he says he wouldn't recommend them _in
           | most_ situations. It's a part that a lot of people here
           | seemed to have missed whether arguing for or against box
           | plots.
           | 
           | >Despite making more visual sense than box plots, I still
           | wouldn't recommend these design concepts or box plots _in
           | most situations_ because...
           | 
           | (Emphasis mine)
        
             | Ringz wrote:
             | From the article:
             | 
             | ,,So, no, I can't think of any situations when a box plot
             | would be the truly best choice, other than those in which
             | the audience demands box plots because that's what they're
             | used to seeing. If you can think of any such situations,
             | though, please let me know on LinkedIn or Twitter."
             | 
             | ,,Other reviewers suggested that the conclusion should be
             | that box plots are a useful chart type, but only for
             | statistically savvy audiences. Again, I'm going a step
             | further, suggesting that even those audiences would be
             | better served by other chart types in virtually all
             | situations."
        
           | cjk2 wrote:
           | Comparing location, spread and skew of multiple batches.
        
           | rzmmm wrote:
           | Often people are interested in exact quantitative statistics
           | like IQR, median, top/bottom deciles which are commonly
           | represented in box plots. The alternatives are visually
           | simpler but they contain less quantitative information.
        
             | oefrha wrote:
             | The alternative plots in TFA after
             | 
             | > Design concepts such as the ones below make more 'visual
             | sense' than box plots:
             | 
             | present the exact same info in much less visually confusing
             | ways, through the use of brightness (weight) and area. Just
             | better box plots.
             | 
             | And of course you can always draw some lines for the
             | quartiles on any kind of plot with a linear scale for the
             | value.
        
             | ajuc wrote:
             | If you want quantititive information it's better to use a
             | table anyway - precisely because it doesn't mislead you
             | about the internal distribution.
        
         | rcxdude wrote:
         | Nah, there's nothing in a box plot which _assumes_ a bell-
         | shape. It does, however just visualise the parameters which
         | reasonably well characterize a smooth single-mode distribution
         | regardless of the underlying distribution. So it 's a valid
         | criticism of using box plots, especially when the alternatives
         | can just as well visualise a bell-shaped distribution, as well
         | as showing when it is not.
        
           | quietbritishjim wrote:
           | > smooth single-mode distribution
           | 
           | That IS a bell curve. While it's true that the Guassian
           | distribution is often called a bell curve or even "the" bell
           | curve, a non-Guassian single mode distribution is still
           | absolutely bell shaped in a general sense.
           | 
           | So, although you started your comment with "nah", you're
           | actually in agreement with the content you replied to.
        
             | conformist wrote:
             | In the mathematical sense this is clearly not true - it's
             | easy to come up with a smooth single mode distribution that
             | doesn't look like a bell.
        
               | thaumasiotes wrote:
               | Is it? How?
               | 
               | You could include a lot of little bells far from the
               | single mode, but that's reading a little too much into
               | the literal meaning of "single mode" - a "bimodal"
               | distribution isn't one where the two most common values
               | are both modes. It's one where there are two distinct
               | local maxima.
               | 
               | The tails to the left and right must asymptotically
               | approach zero (or you don't have a smooth distribution,
               | because you have discontinuities somewhere), and if
               | there's just one local maximum, your curve will look like
               | a bell.
        
               | commathingy wrote:
               | The exponential distribution (modal value 0) is not bell
               | shaped. If you don't like it's range of non-negative,
               | then take some smooth mollification
        
               | thaumasiotes wrote:
               | And the smooth mollification will look like...?
        
               | pxx wrote:
               | in the simplest case... just mirror it (some call this a
               | Laplace distribution). if you don't like how it's not
               | differentiable at the mode there are further smoothings
               | (see, e.g., the wikipedia article for this distribution)
               | but this simple construction is continuous.
        
               | canjobear wrote:
               | It looks like a spike, not a bell.
        
               | cycomanic wrote:
               | A spike is not smooth (typically meaning continuous in
               | the variable and its first derivative), which was one of
               | the conditions.
        
               | timy2shoes wrote:
               | Then take a Cauchy or a t-distribution. Basically
               | anything with a longer tail than exp(x^2). The Gaussian
               | summary will be misleading because of the tails.
        
               | seanhunter wrote:
               | Yes or the chi-square distribution with k=1 or 2 or any
               | other of the gamma distributions[1] with the right
               | parameters will have a shape that is one-sided with the
               | mode at the lower extreme and no "low tail" in the normal
               | sense.
               | 
               | [1] https://en.wikipedia.org/wiki/Gamma_distribution or h
               | ttps://stats.libretexts.org/Bookshelves/Probability_Theor
               | y/...
        
               | davidguetta wrote:
               | The bell curve IS the smooth single mode with LOWEST
               | ENTROPY.
        
               | nequo wrote:
               | Do you mean greatest entropy? Not if the support is, for
               | example, the positive reals.
        
           | kazinator wrote:
           | The problem is that the four quantile groups contain equal
           | numbers of items, but are not represented by equal areas,
           | even if we replace the whiskers with a bar of the same width
           | as the box.
           | 
           | The bottom whisker contains 25% of the data, yet is just a
           | thin line, which can furthermore be arbitrarily short.
           | 
           | It really is a dumb visual presentation.
           | 
           | The only way to use it is to recover the five parameters from
           | it, _and then stop looking at it_.
           | 
           | For that purpose, a QR code would be just as good, if not
           | better. You'd need a device with a camera to get the
           | parameters (but "everyone" has that now), and when you're
           | looking at it with your bare eyes, it doesn't tell you any
           | visual lie.
        
             | seanhunter wrote:
             | > The only way to use it is to recover the five parameters
             | from it, and then stop looking at it.
             | 
             | ...which is its intended use case since Tukey invented it
             | as a way of visualising the "5 number summary". I think
             | part of his criteria were that it should be easy to make by
             | hand which is clearly no longer a consideration so there
             | are plenty of reasons to just do something else most of the
             | time these days.
        
         | wesleywt wrote:
         | This is exactly why the author says you should stop using Box
         | plots. The plot is easy to misinterpret.
        
         | IanCal wrote:
         | > they assume that your data follows a bell/gaussian shape
         | 
         | No they don't. They show quartiles mostly, and don't assume
         | symmetry or any parameters of a gaussian.
        
           | kamma4434 wrote:
           | What you say is technically correct, but in the sense where
           | you can put rat poison in One of those ceramic cookie jars
           | they sell in houseware shops. There is nothing wrong in doing
           | it, but it may lead to interesting failure modes Because
           | someone can have implicit assumptions about what's in there.
        
             | afiori wrote:
             | Quartiles are relevant for almost any distribution
        
               | crazygringo wrote:
               | If by "almost any" you mean "unimodal".
               | 
               | Quartiles are not relevant, i.e. can be highly
               | misleading, for a bimodal distribution or beyond...
        
               | afiori wrote:
               | they are misleading if you assume unimodality, but are
               | always relevant. If you care about how many modes there
               | are then likely you would prefer deciles or centiles.
               | 
               | But even in the first image of the article the fact that
               | two quartiles are close together means that there some
               | density peak around there.
               | 
               | I agree with the author that box plots are not good
               | plots, but quartiles/deciles/medians are useful even for
               | multimodal distributions
        
         | amelius wrote:
         | A bell shape has no minimum/maximum, like the box has.
        
           | Hendrikto wrote:
           | In theory. In pratice you always have a finite sample size
           | and thus a min and max.
        
         | lkdfjlkdfjlg wrote:
         | Boxplots don't assume anything about your data. They just
         | measure percentiles and put them on the y-axis.
        
         | vehemenz wrote:
         | The argument is more about the relation between the
         | visualization and the audience, not the data and the
         | visualization. I see a lot of commenters missing this point.
        
         | jncfhnb wrote:
         | > people need to understand the basics of statistics before
         | they can use them.
         | 
         | > they assume that your data follows a bell/gaussian shape.
         | This is correct in cases where the central limit theorem can be
         | applied (which is almost everywhere)
         | 
         | You sir just failed basic statistics
        
         | fnordpiglet wrote:
         | Sorry I don't understand. The central limit theorem describe
         | the distribution of the sample means from a population. It
         | describes the distribution of the mean, not the distribution of
         | the population itself. The shape of the distribution of the
         | sample mean isn't super interesting when you're interested in
         | the distribution of the samples themselves as a proxy for a
         | population. So I'm not sure I understand your assertion. Could
         | you explain more your reasoning? Maybe I'm missing something,
         | but the estimation of the sample mean distribution isn't the
         | only metric that's useful, and almost nothing in nature is
         | normally distributed otherwise. Normal distributions are
         | generally a useful assumption mostly because of the analytic
         | form of the Gaussian and our understanding of how to work with
         | it. But that estimation isn't useful as it might seem. A
         | Poisson distribution is much more common for instance.
        
           | sigmoid10 wrote:
           | I't appears you don't understand the central limit theorem
           | fully. You gave the definition you find in textbooks, but you
           | don't see how it applies to real world measurements and
           | already explains your question. I can only recommend to visit
           | a university level statistics course at this point. Maybe you
           | will understand when you actually deal with some real data.
           | Then you will indeed see its consequences pop up everywhere.
           | The issue (also for the blog author) is that it is often
           | implicitly assumed. It is one of many common pitfalls in
           | statistics. You should also learn what the difference is
           | between a poisson and a gaussian distribution. They may look
           | similar, but there is a drastic difference in their
           | definition and they are used in very different circumstances.
        
             | jncfhnb wrote:
             | The GP here did not claim a poisson was the same thing as a
             | Gaussian. They also don't look similar.
             | 
             | As far as I can tell you're making the introductory student
             | error of thinking the central limit theorem means any
             | sufficiently large sample makes a distribution look normal.
        
         | crazygringo wrote:
         | Yes.
         | 
         | A lot of people here are commenting that no, technically box
         | plots don't assume any distribution. And I mean, technically
         | you can ride from NYC to SF in a lawnmower.
         | 
         | But I completely agree that box plots _shouldn 't_ ever be used
         | for anything but unimodal distributions similar enough to a
         | bell/gaussian distribution.
         | 
         | All of the criticism of the article seems to be that they're
         | misleading when the distribution is not bell/gaussian, e.g.
         | bimodal.
         | 
         | To which my reply is, of course. Box plots shouldn't be used
         | then. But if your distribution _is_ bell /gaussian, they seem
         | fine and I see no particular issue with them.
        
           | pictureofabear wrote:
           | This article is very click-baity.
           | 
           | Boxplots are a single tool for data analysis. They do not
           | apply in every situation, nor do any other tools. The same
           | goes for pie charts, which are constantly being accused of
           | always distorting data. Pie charts, like box plots, have
           | their place.
        
           | hoosieree wrote:
           | Murphy's law for data viz:
           | 
           | If a plot _can_ mislead, it _will_.
        
           | theamk wrote:
           | Well, how do you readers know if your distribution is
           | bell/gaussian? Sure, sometimes you plot means of large
           | samples, and then it is true by construction; but a lot of
           | time people use box plots when there is no intrinsic reasons
           | for data to be gaussian. Like most experimental papers.
           | 
           | Or take the first example from wikipedia page on box plot
           | [0]: "Box plot of data from the Michelson experiment", which
           | is just 20 points per run. Would I want to see this in the
           | paper? No please. There is no evidence that the experimental
           | data is gaussian (or even single-modal). Or further down that
           | page, "A series of hourly temperatures" - why would one box-
           | plot it either?
           | 
           | And even if you claim your data is gaussian by construction,
           | maybe because you surveyed lots of people - I still want to
           | see the evidence, as it's pretty simple to make experimental
           | mistakes that turns data non-gaussian (say you only surveyed
           | two neighborhoods with very different properties)
           | 
           | In other words, the domain where box plots are sufficient is
           | very small. Most publications should never use them.
           | 
           | [0] https://en.wikipedia.org/wiki/Box_plot
        
           | mannykannot wrote:
           | The article's full argument seems to be that there are
           | alternatives which are applicable where box plots are not
           | and, at least in most cases, better where they are (there is
           | a tacit (IIRC) subtext of "given that we're using software to
           | do the plotting.")
           | 
           | This is debatable, but noting that box plots are satisfactory
           | for unimodal gaussian-ish distributions is not a very
           | persuasive response.
        
         | imachine1980_ wrote:
         | Could you please elaborate on the reason? I assume it's related
         | to a unique null derivative instead of multiple maxima, but I
         | couldn't find any papers or information on this.
         | 
         | Additionally, I find the article informative but believe it
         | could be improved with this clarification. As someone who has
         | worked with data analytics but is not a mathematician or
         | actuary, I know people who probably review these types of
         | graphs. Now, I understand that it is essential to check the
         | underlying data distribution to avoid being misled by the
         | information, even if the source and axes seem trustworthy
        
           | sigmoid10 wrote:
           | >related to a unique null derivative instead of multiple
           | maxima
           | 
           | I think the word you're trying to use is "bimodal" and yes,
           | that is one example where the author's reasoning fails. But
           | it's not the only one.
           | 
           | >I couldn't find any papers or information on this.
           | 
           | You said you have no formal higher education in mathematics -
           | how would you even go about finding (let alone understanding)
           | papers? Regardless, just to be clear, this is not something
           | you would learn from papers but from introductory textbooks
           | and university courses. Everyone who has to deal with
           | statistics in science needs to go through a whole lot of
           | extra education exactly because there are many pitfalls like
           | this.
           | 
           | >it is essential to check the underlying data distribution to
           | avoid being misled by the information
           | 
           | That is another half-truth that everyone on the outside seems
           | to agree on, but it is useless in practice. What do you do if
           | the underlying data is not accessible. And what if you don't
           | have the means to process it for every paper you read (which
           | is what usually happens)? Then you have to rely on the actual
           | tricks of the trade, which will come naturally if you worked
           | with tons of statistics before. There are lots of telltale
           | signs that let you spot bad analyses by only looking at a
           | plot or summary chart. Granted, you won't catch all of them,
           | but it often takes real malice and deep statistical
           | competence on the author's side to cover up these things.
        
         | kylebenzle wrote:
         | Yes! You are right and my gears were grinding the whole time
         | reading that article because right of the bat they make some
         | gross and incorrect assumptions.
         | 
         | A box plot isn't trying to show the same thing a histogram is,
         | it's like saying we should stop using Venn diagrams because
         | they confuse people when trying to show the exact amount of
         | overlap, so pie charts are better...
         | 
         | It's silly.
        
         | chipdart wrote:
         | > Box plots don't make anything bell shaped (...), they assume
         | that your data follows a bell/gaussian shape.
         | 
         | Not true. Box plots represent low and and high quantiles
         | independently and support the representation of outliers.
         | 
         | This alone is enough to make it clear for everyone that they
         | don't require a distribution to be symmetric, let alone bell
         | shape.
        
       | mkl wrote:
       | The only advantage box plots had is that they can be drawn by
       | hand. Now that computers are ubiquitous this is no longer
       | valuable.
       | 
       | Violin plots and bee swarm plots are better. Jittered strip plots
       | can be okay if you're careful to avoid saturation (or more points
       | added in the saturated region will disappear as they can't make
       | it any darker).
        
         | frodo8sam wrote:
         | I'll take a plain histogram/kde plot every day of the week over
         | those damn violin plots. I think box plots are quite usefull as
         | they are easy to read but only if you trust the author has
         | actually looked at the histogram. And you can typically not
         | trust the author to have done that.
        
           | mkl wrote:
           | Violin plots essentially are KDE plots, but you can put
           | multiple of them on the same axes to compare groups.
        
           | medstrom wrote:
           | Perhaps you'd find the half-violin plot more readable? Seems
           | there's a whole world of all-in-one "raincloud plots" that
           | integrates them, like the lower infographic here: https://raw
           | .githubusercontent.com/Z3tt/TidyTuesday/main/plot...
           | 
           | You can even make 'em show histograms:
           | https://miro.medium.com/v2/1*J3Q4JKXa9WwJHtNaXRu-kQ.jpeg
        
             | catlifeonmars wrote:
             | For the latter, it looks like the histogram is probably
             | sufficient. The violin plot just adds extra visual noise.
        
           | klysm wrote:
           | A violin plot is literally just a KDE sideways.
        
             | seanhunter wrote:
             | It also has a box plot tacked on because "why not"?
        
         | jhbadger wrote:
         | I'm surprised the article just briefly mentions violin plots.
         | Those are becoming popular in biomedical research -- much more
         | common than the plots he suggests. And you can always overlay
         | them with the jittered points if you want too.
        
         | j_bum wrote:
         | I disagree about violin plots being better.
         | 
         | Here is a great rant (borderline lecture) from Angela Collier
         | on why they aren't [0]
         | 
         | [0] https://youtu.be/_0QMKFzW9fw?si=86mRAZRnFCBfSzw0
        
           | sanderjd wrote:
           | Could you summarize the criticisms in this (pretty long)
           | video, and what she is proposing as a better alternative
           | (beanplots? or is she criticizing those too?)? I couldn't
           | figure it out from perusing the transcript.
           | 
           | I think it's useful to be able to compare the approximate
           | shapes of histograms during exploratory data analysis. Is the
           | thesis of this criticism that this isn't actually a useful
           | thing to do, or that violin plots don't achieve this, or is
           | it "just" an aesthetic argument?
        
             | interroboink wrote:
             | Her criticisms of violin plots seem to be (1) they combine
             | histogram-style information with box-plot-style
             | information, when you generally would only want one or the
             | other [ie: don't use boxplot for bimodal, don't use
             | histogram when boxplot suffices], (2) The histogram-style
             | information is not comparable between blobs of data, since
             | they're not visually aligned, have no tick marks, etc -- a
             | plain histogram is better for this, and (3) she finds them
             | ugly on a personal level.
             | 
             | EDIT: Maybe she'd be fine with using them in an exploratory
             | manner. She seems to mainly be complaining about using them
             | in publications, meant for other people to consume. Also: I
             | did not watch the entire video (:
        
               | sanderjd wrote:
               | Thanks for this summary! I definitely hadn't seen the
               | point about comparability between blobs of data because
               | of the alignment. But that really seems like an odd point
               | to me, as I almost entirely see / use these with time
               | series data, where pretty much the whole point is to
               | compare the evolution of the values over time using their
               | "vertical" location, with a was to see the shape of a
               | distribution of values at each point in time, at a
               | glance.
        
             | SebastianKra wrote:
             | Her argument that convinced me, is that the same result can
             | always be better represented with multiple histograms -
             | z-stacked, side-by-side, 3D or ridgeline-plots (ridgeline
             | plots look awesome). Check out her examples at 21:11.
             | 
             | Compared to these alternatives, violin plots are comically
             | bad.
        
             | Aachen wrote:
             | The two other replies are her main point(s), but the video
             | also spends some time on another issue that she labels as
             | minor but I found interesting to hear the perspective on.
             | I'll try to do it justice:
             | 
             | They look like vulvas. We're all adults, it's not a problem
             | typically, but given that it's an aesthetic choice
             | (noticing how half of the chart conveys the same info
             | without this property), why? And it does come up, like if
             | someone does make a joke about it, a room full of typically
             | only well-meaning men will now look to her if she's
             | comfortable with the joke and, what was okay before, now
             | turns into a feeling of being singled out and outside the
             | rest of the group
        
             | seanhunter wrote:
             | The summary is she is saying you almost always want to show
             | one of two things (and not both):
             | 
             | 1) To show the distribution, in which case just the
             | histogram arranged horizontally in the traditional fashion
             | is far better than a violin plot with 2 copies of the
             | histogram vertically and some extra quartile stuff tacked
             | on, especially since lots of standard libraries to do
             | violin plots do kde with very extreme smoothing so the
             | distribution they show can be very misleading as to the
             | real empirical distribution.
             | 
             | 2) To highlight the summary statistics (quartiles and
             | median) in which case just the boxplot is better because
             | generally these are hard to read on a violin plot
             | 
             | In case #1 this is usually because the distribution differs
             | significantly from a Gaussian in some interesting way that
             | would make a boxplot irrelevant or misleading. (eg it is
             | bimodal or multimodal).
             | 
             | In case #2 this is usually because the distribution is
             | Gaussian (or otherwise standard) and you want to compare it
             | with other standard distributions. You don't need all the
             | information in the histogram and to include it all would
             | obscure the important point(s) you're trying to make about
             | the median and quartiles. What is considered standard is
             | going to depend a lot on the domain, audience and subject
             | matter. In her case, she's an astrophysicist, so if you're
             | looking at say red shift data from some observation, other
             | astrophysicists will know the distribution you would expect
             | to get from that sort of observation for example.
             | 
             | That video is basically a summary of all the conversation
             | attached to this article in some ways.
        
               | hoseja wrote:
               | 3) They look like THAT
        
               | seanhunter wrote:
               | Well yes.
        
         | klysm wrote:
         | 100% on the money. Box plots are an archaic technique for
         | working around limitations that no longer exist.
        
       | y42 wrote:
       | In short and unsurprisingly: Not every analysis and data set
       | works with every visualisation.
        
       | montebicyclelo wrote:
       | The author has experience of teaching box plots in various
       | organisations.
       | 
       | The author has found that compared to other types of plots,
       | people struggle to learn how to intepret box plots.
       | 
       | The author proposes some alternatives that they believe to be
       | easier for people to interpret:
       | 
       | - Strip plots (for few data points)
       | 
       | - Jittered strip plots (for more data points)
       | 
       | - Distribution heatmap (for even more data points)
       | 
       | ----
       | 
       | This aligns with my experience of trying to convey information to
       | non-technical or moderately technical people; box plots are a
       | struggle for them. To me it does seem like the proposed
       | alternatives would be more accessible.
       | 
       | Sure, we could try to better educate people about box plots, (as
       | the author has done professionally); or we could consider using
       | something that requires less effort for people to comprehend.
        
         | scrollaway wrote:
         | Yeah I'm shocked at the awful quality of comments here. This is
         | a clear and straightforward article laying out the issues with
         | box plots and appropriate alternatives, from a professional who
         | works in the field and spends his life explaining these.
         | 
         | And still half the comments are like "But I know better!"...
         | yeah, I'd wager most here don't.
        
           | SillyUsername wrote:
           | I'm qualified in maths related computing and statistics to
           | exam invigilator level, if that helps offset your bias.
        
             | scrollaway wrote:
             | No bias -- By commenting a lot, you're overrepresenting the
             | average HN audience. Which kind of nullifies your point,
             | doesn't it?
             | 
             | You argue in other comments that it's just an education
             | problem, but box plots are used with people who don't have
             | this exact education you mention, _and_ the article
             | explains that a drawback of box plots is exactly that it
             | isn 't intuitive and takes several minutes of explanations.
             | 
             | In other words, the article says "I've stopped using this
             | because they require education", and your retort is "Don't
             | stop using these, you just need to educate people".
        
             | sloowm wrote:
             | That background would make you explicitly unqualified to
             | asses the quality of box plots as a visualization method.
             | Box plots are used throughout various fields of research
             | that are far less mathematical in nature.
        
               | SillyUsername wrote:
               | Rubbish. They're used extensively in probability
               | statistics and confidence intervals. Field of research
               | has bugger all to do with it :tears:
        
               | sloowm wrote:
               | You not understanding what my comment means is incredibly
               | thematic.
        
         | SillyUsername wrote:
         | I'm not suggesting that the other diagrams shouldn't be used,
         | just that box diagrams aren't wrong, they hide data, which is
         | sometimes useful.
         | 
         | I wish we could educate everyone in the ways data can be
         | misrepresented - scale, non 0 axis starting, omitting
         | categories, combining groups, colours, point sizes not
         | representative of data - and they can all be levelled at other
         | graph types, singling out box plots for hiding is no different,
         | but IMHO not justification for not using them with the right
         | audience.
        
       | wodenokoto wrote:
       | I'm a big fan of the jittered strip plot and I often ad special
       | logic to color dots at the edges of a largish gap. This is super
       | useful if you are plotting the distribution of daily messages and
       | just plotting dots will hide that there are days without messages
        
       | These335 wrote:
       | Sure there are alternatives and I agree with the author's
       | criticisms overall. But boxplots are a staple in statistics, and
       | if your audience can reasonably be assumed to have some level of
       | statistical training then boxplots are perfectly reasonable in my
       | opinion.
        
         | cqqxo4zV46cp wrote:
         | Would you care to address the specific argument that the author
         | makes about not using box plots with audiences? I swear,
         | statisticians are among the most inertia-prone groups of people
         | that I've ever worked with. You need a certain degree of "do it
         | this way because it's done this way" to deal with the amount of
         | BS going on in this field.
        
         | sloowm wrote:
         | Are you sure that well trained audiences are able to accurately
         | asses box plots. For instance, most drivers think they are
         | better than average drivers.
         | 
         | It being a staple in statistics is also not a good argument.
         | The information conveyed through box plots is used in lots of
         | fields with different education backgrounds. If a
         | visualization, which in itself is a human simplification of
         | data, is hard to understand, it will be misunderstood by some.
         | This means these people will not be able to advance their field
         | of research as well as with better visualization methodologies.
        
       | CuriouslyC wrote:
       | Box plots are a relic of a time when we couldn't print really
       | nice charts. You can just display the distribution in line like a
       | scrolling oscilloscope/topographic display, or you can do a
       | density plot over time (look at gaussian processes) and overlay
       | shaded regions for important time periods.
        
       | zaptheimpaler wrote:
       | I always find new types of plots very interesting. Is there a
       | nice resource showing all the common types of plots, when to use
       | them, alternatives, code etc?
        
         | amelius wrote:
         | https://matplotlib.org/stable/plot_types/index
         | 
         | https://d3-graph-gallery.com/
        
         | cb321 wrote:
         | The @amelius sibling has nice links to "graphics" choices, but
         | I feel like the overall topic of the original article and this
         | comment thread is more about the interaction of that with
         | "statistical choices" as per my other comment
         | (https://news.ycombinator.com/item?id=40766618) pointing to
         | plots you might like to peruse.
         | 
         | For example, though the final example in the reference there is
         | graphically "only" shading the "outer band" darker than the
         | inner alpha-blended region, this seems important
         | statistically/visualization-wise since the unknown true parent
         | distribution/ensemble samples are, well, sampled from need only
         | be any monotonic curve within the whole region.. (not even
         | differentiable if mixed discrete-continuous values may happen).
        
       | singingfish wrote:
       | And no mention of notched box plots which make a lot of the
       | troublesome aspects go away?
        
       | kkfx wrote:
       | Honestly? I do not care much about charts in general, while I do
       | care much about the availability of the data used to produce a
       | chart... In way too much cases I see plots and no data, sometimes
       | data are there but not easy to use, and another thing I do care
       | is the ability to tweak a graph.
       | 
       | The above are between the reasons I prefer remote meeting where
       | data are to be shown instead of in person: anyone attending
       | should have a computer ready to use and IF data are shared and
       | ready usable I can live tweaks a plot ad reason on it while I
       | listen end eventually pose relevant questions shown at my own
       | turn something. Surely not all presentations are meant to be
       | interactive session, but being able to interact even in async
       | form reading a journal article, playing with the data and
       | eventually drop a mail to the author is a nice thing, typically
       | uselessly hard today where in tech term it can be extremely
       | simple.
       | 
       | That's another reason I have presentation software/office
       | automation one instead of plain org-mode, Jupyter, R Studio etc
       | because change things it's hard while it should be easy. Org-mode
       | is excellent to present but not really interactive, I have to
       | regenerate plots to see changes or push data to external
       | software, Jupyter is not really meant to present, R Studio offer
       | nice LaTeX integration and tabular view but do not offer nice
       | means to present, though they are still FAR better then
       | presentation software and even if have some safety aspects to be
       | taken into account I prefer countless of time receiving an active
       | document (org-mode, jupyter notebook etc) instead of a pdf or
       | even worse some office formats.
        
       | karmakaze wrote:
       | > There are other distribution chart types that can be useful in
       | specific situations, such as frequency polygons, violin plots,
       | cumulative distribution plots, and bee swarm plots, but the three
       | types that I described above are the easiest ones to grasp, and
       | are able to communicate most of the insights that are needed for
       | day-to-day decision-making in most organizations. (I'm not
       | mentioning histograms here because they're generally only useful
       | for visualizing a single set of values, whereas box plots and
       | their alternatives are for visualizing multiple sets of values,
       | which is a different use case.)
       | 
       | There's generalizations and 'specific situations' which the
       | author considers worthy of some plots, and other specific
       | situations that the author doesn't consider worthy of other
       | plots. At best, don't use box plots if your distributions do not
       | have a single mode and may likely be misinterpreted is my
       | takeaway. Here's a rant against violin plots by my fave physicist
       | ranter[0] (not Sabine), so maybe never use them.
       | 
       | [0] https://youtu.be/_0QMKFzW9fw?si=4VM4DT9Q1zEnV93A
        
       | cb321 wrote:
       | People have conflicting goals. On the one hand they _long_ to
       | compress many numbers into one or a few summary statistics. On
       | the other hand, the _moment_ such lusted after summaries mislead
       | in _some way_ they regret the data compression. What 's really
       | going on is that people want a simplicity (often in the form of
       | definite conclusions) which may just not exist. This is really a
       | common malaise of the human condition.
       | 
       | Similarly, the distribution represented by a box plot itself is
       | often the distribution of "just one sample". When viewed as such,
       | a distro has _its own uncertainty_ [1] and that uncertainty is
       | not represented in a violin plot, for example. As with every
       | "right tool for the job" debate, people will vary based on
       | experience with the tools, including how to simplify/explain them
       | to others.
       | 
       | [1] https://github.com/c-blake/bu/blob/main/doc/edplot.md
        
       | riedel wrote:
       | Actually you may nicely integrate box, violin, bee/scatter plots
       | [0]. For simple visual ANOVA testing box plots are great. On the
       | other hand violin plots are great to quickly check distribution
       | assumptions for testing and together with scatter plots give you
       | a good impression of the sample.
       | 
       | [0] https://davidbaranger.com/2018/03/05/showing-your-data-
       | scatt...
        
       | iainmerrick wrote:
       | Lots of people defending box plots here -- a lot more than I
       | expected!
       | 
       | What I don't see is anyone saying "box plots are useful because
       | they're the best kind of chart for [specific use case]". I can't
       | off-hand think of any situation where I'd rather see a box plot
       | than a strip plot or violin plot. When and why would you want to
       | summarise the data so coarsely and visualize it so un-
       | intuitively?
        
         | lkdfjlkdfjlg wrote:
         | > What I don't see is anyone saying "box plots are useful
         | because they're the best kind of chart for [specific use
         | case]".
         | 
         | Box plots are useful because they're the best kind of chart for
         | when I have multiple populations and I want to quickly glance
         | whether it's reasonable to assume that the populations have the
         | same median, or not (you do that comparing not just the medians
         | of the populations but also the shaded areas)
        
           | johnbcoughlin wrote:
           | I can't see why a jitter plot with dark lines marking the
           | quartile wouldn't be strictly better for this.
        
             | aniviacat wrote:
             | That's just a box plot with extra steps.
             | 
             | Sure, the jitter plot provides more data, but if you only
             | make use of the quartiles anyway, that extra data is but an
             | unnecessary distraction.
        
           | weebull wrote:
           | If you're only comparing medians, then just plot the medians.
           | Why a box plot with the quartiles?
        
             | lkdfjlkdfjlg wrote:
             | Ok, so the difference between medians is 42.7. Is that a
             | lot or a little?
        
         | DonsDiscountGas wrote:
         | Violin plots are massively overhyped, IMHO. If your data is
         | simple and unimodal, use a boxplot. If the distribution is more
         | complicated and you need some detail, use a histogram or a
         | ridge plot. Violin plots are never the best option; they're
         | curvy so a little more pretty but don't do a good job of
         | conveying information.
        
           | inciampati wrote:
           | They really help when you're working with huge numbers. It's
           | just a different kind of density plot. A vertical histogram
           | can be nice too. Or you can use color and overlay a few
           | regular old histograms. Go wild.
        
             | parpfish wrote:
             | Overlaid histos can be confusing because people don't know
             | if they are stacked or overlapped.
             | 
             | One solution is to smooth into a kde and then use
             | transparency to indicate overlap, but that's introducing
             | more complexity than you want for a quick n dirty first
             | pass
        
           | weebull wrote:
           | > If your data is simple and unimodal, use a boxplot.
           | 
           | How is the reader to know you've used the right plot? How are
           | they to know that you haven't hidden a bimodel dataset behind
           | a box plot because it makes your conclusions easier?
           | 
           | > If the distribution is more complicated and you need some
           | detail, use a histogram or a ridge plot. Violin plots are
           | never the best option; they're curvy so a little more pretty
           | but don't do a good job of conveying information.
           | 
           | They are just multiple, non-overlapping histograms plotted
           | next to each other. They allow you to compare distributions
           | without them getting in the way of each other.
           | 
           | I can understand if it's the fitted PDF that you think hides
           | the original data. That is unnecessary IMHO.
        
         | kaitai wrote:
         | I deal with a lot of business people who have processes that
         | rely on 15th/85th percentile, or 25th/75th percentile. They
         | want to see the median, the low/high percentiles, the max/min
         | or outliers, and they don't want to see all the data points
         | jittered in between. It's just overwhelming extraneous
         | information. They in fact like tables with those numbers
         | written down, but they want to compare ten different (time
         | series of historical prices for different markets) and see it
         | on one Powerpoint slide. The box plot allows a fast visual
         | comparison of medians and other key percentiles (label the plot
         | with the percentiles if you're doing something non-standard!).
         | With jitter or violin they get hung up on weird random stuff
         | and it derails meetings.
         | 
         | Important caveats: the generating processes for all these
         | quantities are the same in a physical sense, so they are
         | comparable. All the distributions are roughly lognormal-ish, so
         | they are single-peaked distributions, as folks are discussing
         | here. The point of the visualization in theses cases is not to
         | understand the properties of the distribution per se, it's to
         | show the important percentiles because they have business
         | implications.
        
           | iainmerrick wrote:
           | That's a good explanation, thank you!
        
           | callalex wrote:
           | Who drew those boundaries at 15/85? What makes those
           | boundaries useful or correct?
        
             | s1artibartfast wrote:
             | It sounds like they are business relevant parameters. They
             | are self selected and independent of the data or
             | distribution.
             | 
             | The point is that they are parameters of relevance to
             | observer.
             | 
             | I work in medicine sometimes work with box-plots for this
             | reason. The questions "what is the 25th percentile outcome"
             | is perfectly legitimate
        
         | s1artibartfast wrote:
         | >When and why would you want to summarise the data so coarsely
         | and visualize it so un-intuitively?
         | 
         | Sometimes less is more; Box plots are specifically good for
         | showing and comparing quartiles.
         | 
         | If you want to compare several groups and care about gross
         | differences, they are an excellent tool. They are an excellent
         | to when you believe the data is normal and think the histogram
         | is misleading. they are also great if you think the data isnt
         | normal but care about quartiles.
         | 
         | Any time you would be happy with a table of the 5 datapoints
         | (min, max, median, 25th, and 75th percentiles), box plots a
         | great tool for graphic comparison.
        
       | michaelhoffman wrote:
       | Wherever possible, I use sina plots, which provide many of the
       | advantages of violin plots while actually showing the individual
       | data points.
       | 
       | https://en.wikipedia.org/wiki/Sina_plot
       | 
       | https://cran.r-project.org/web/packages/sinaplot/vignettes/S...
       | 
       | Adding on a representation of mean in a different style (like a
       | black bar) can be helpful. So can a boxplot-style indication of
       | variance, in some cases.
        
       | benrapscallion wrote:
       | Do it the way Nature journals now require it to be done: show the
       | underlying data points overlaid on the box plot. Best of both
       | worlds.
        
       | inSenCite wrote:
       | been in love with violin plots
        
       | chefandy wrote:
       | Just like anything else in design, the first question should be
       | "how can I convey this most clearly to the audience I'm
       | addressing" not "hmm, I wonder if there's are any problems the
       | technique I chose because it's what everyone seems to use for
       | this." Use the right tool for the job. There's even a good chance
       | that juxtaposing these elements differently or adding another
       | element could clear this up entirely.
       | 
       | This is why it's good to have a really competent visual designer
       | around. Their sole purpose is visual communication, and that very
       | much includes dealing with the subconscious connotations and
       | unintended messages hidden within data visualizations. Yes,
       | you've probably encountered designers that would not be good at
       | that, you imagine. You've also probably encountered developers
       | that would not be good at the sort of data munging that
       | scientists, et al do; that doesn't mean developers, generally,
       | aren't best equipped to handle the related coding problems.
        
       | svara wrote:
       | The alternatives he proposes have their problems too.
       | 
       | Just plotting points will lead to saturation in high density
       | areas that depends on point size and opacity.
       | 
       | Making bin color proportional to point density will require
       | normalization to make the plot readable in many cases.
       | 
       | While I like these plots too in certain situations, I would argue
       | they're actually less elegant than the boxplots for those
       | reasons.
       | 
       | And come on, boxplots aren't that hard to explain to someone who
       | already is used to working with percentiles.
        
       | klysm wrote:
       | I think there is an aversion to just showing the damn
       | distribution as a histogram or KDE. I hear arguments from product
       | owners that it's "too complex" etc.
        
       | jncfhnb wrote:
       | The author showed jittered strip plots where you plot each point
       | correctly on the y axis and randomly offset the x axis.
       | 
       | These are ok but it's hard to differentiate the density of points
       | when they're randomly offset. Try a swarm plot (seaborn) / bee
       | swarm plot (R).
       | 
       | It's the same concept but the points are strategically placed
       | across the x axis to show the width of the distribution at each
       | point. It generally looks much cleaner.
        
       | emilk wrote:
       | Importantly, box plots are also ugly. Beauty matters.
        
       | Falkon1313 wrote:
       | I was not entirely convinced by the article, being used to box
       | plots myself for several decades. I've used them in school,
       | college, and at work.
       | 
       | But after having read these comments, it really drives home his
       | point that you can get a room full of lots of very smart people
       | who all know what they're talking about, and they'll all disagree
       | about the understanding and interpretation of box plots.
       | 
       | It's a little surprising, but the evidence in these threads
       | pretty much cinches the argument for me.
        
       | flusteredBias wrote:
       | ECDF plots are what I use.
        
       | __mharrison__ wrote:
       | I've resorted to just teaching four plot types when I teach
       | visualization.
       | 
       | - Bar
       | 
       | - Scatter
       | 
       | - Line
       | 
       | - Histogram
       | 
       | You can tell 90% of your stories with these plots. (If you pay
       | attention to professional viz groups, Economist, NY Times, etc,
       | they use these.)
       | 
       | Don't waste your time with other plots unless you have mastered
       | these. When you master these, you will realize you don't need
       | other charts.
        
       | moi2388 wrote:
       | I'm probably wrong, but this entire article felt as an
       | advertisement for violin plots without it being mentioned once
        
       | pvaldes wrote:
       | That problem has been solved long time ago. When a box plot is
       | not enough, just use violin plots
       | 
       | On gnu-R:
       | 
       | install.packages('ggplot2')
       | 
       | ?ggplot2::geom_violin
        
       | Kalanos wrote:
       | Plotly has an option on box plots that shows the individual
       | points as well, which I like better than violins
        
       | greentxt wrote:
       | Just use a heat map instead. /s
        
       ___________________________________________________________________
       (page generated 2024-06-24 23:02 UTC)